Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 72599..73434 | Replicon | chromosome |
Accession | NZ_LR890714 | ||
Organism | Escherichia coli isolate MSB1_6C-sc-2280315 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LDL9 |
Locus tag | JMW19_RS00305 | Protein ID | WP_001094444.1 |
Coordinates | 72599..72976 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7LDN9 |
Locus tag | JMW19_RS00310 | Protein ID | WP_001285607.1 |
Coordinates | 73066..73434 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW19_RS00275 | 67948..68871 | - | 924 | WP_000535949.1 | carboxylate/amino acid/amine transporter | - |
JMW19_RS00280 | 68982..70166 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
JMW19_RS00285 | 70594..70776 | - | 183 | WP_177309578.1 | hypothetical protein | - |
JMW19_RS00290 | 70960..71802 | - | 843 | WP_000036706.1 | DUF4942 domain-containing protein | - |
JMW19_RS00295 | 71899..72096 | - | 198 | WP_000839266.1 | DUF957 domain-containing protein | - |
JMW19_RS00300 | 72114..72602 | - | 489 | WP_000761680.1 | hypothetical protein | - |
JMW19_RS00305 | 72599..72976 | - | 378 | WP_001094444.1 | TA system toxin CbtA family protein | Toxin |
JMW19_RS00310 | 73066..73434 | - | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW19_RS00315 | 73514..73735 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
JMW19_RS00320 | 73822..74298 | - | 477 | WP_053289525.1 | RadC family protein | - |
JMW19_RS00325 | 74314..74793 | - | 480 | WP_000844100.1 | antirestriction protein | - |
JMW19_RS00330 | 74875..75693 | - | 819 | WP_072649142.1 | DUF945 domain-containing protein | - |
JMW19_RS00335 | 75783..76016 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
JMW19_RS00340 | 76022..76699 | - | 678 | WP_001097301.1 | hypothetical protein | - |
JMW19_RS00345 | 76847..77527 | - | 681 | Protein_68 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14087.02 Da Isoelectric Point: 7.3523
>T291920 WP_001094444.1 NZ_LR890714:c72976-72599 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SVCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SVCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | B1LDL9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0JLU8 |