Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5198656..5199281 | Replicon | chromosome |
Accession | NZ_LR890710 | ||
Organism | Klebsiella pneumoniae isolate KSB2_9B |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | JMX55_RS25295 | Protein ID | WP_002882817.1 |
Coordinates | 5198656..5199039 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | JMX55_RS25300 | Protein ID | WP_004150355.1 |
Coordinates | 5199039..5199281 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX55_RS25280 | 5196022..5196924 | + | 903 | WP_004901686.1 | formate dehydrogenase subunit beta | - |
JMX55_RS25285 | 5196921..5197556 | + | 636 | WP_004901683.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMX55_RS25290 | 5197553..5198482 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
JMX55_RS25295 | 5198656..5199039 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMX55_RS25300 | 5199039..5199281 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMX55_RS25305 | 5199486..5200403 | + | 918 | WP_004901674.1 | alpha/beta hydrolase | - |
JMX55_RS25310 | 5200417..5201358 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
JMX55_RS25315 | 5201403..5201840 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMX55_RS25320 | 5201837..5202697 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
JMX55_RS25325 | 5202691..5203290 | - | 600 | WP_004901669.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T291918 WP_002882817.1 NZ_LR890710:c5199039-5198656 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |