Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4716363..4716879 | Replicon | chromosome |
Accession | NZ_LR890710 | ||
Organism | Klebsiella pneumoniae isolate KSB2_9B |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JMX55_RS22990 | Protein ID | WP_023317444.1 |
Coordinates | 4716363..4716647 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMX55_RS22995 | Protein ID | WP_002886901.1 |
Coordinates | 4716637..4716879 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX55_RS22965 | 4711758..4712066 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
JMX55_RS22970 | 4712151..4712324 | + | 174 | WP_032408826.1 | hypothetical protein | - |
JMX55_RS22975 | 4712327..4713070 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMX55_RS22980 | 4713427..4715565 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMX55_RS22985 | 4715895..4716359 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMX55_RS22990 | 4716363..4716647 | - | 285 | WP_023317444.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX55_RS22995 | 4716637..4716879 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMX55_RS23000 | 4716957..4718867 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
JMX55_RS23005 | 4718890..4720044 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
JMX55_RS23010 | 4720111..4720851 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11151.99 Da Isoelectric Point: 10.3787
>T291916 WP_023317444.1 NZ_LR890710:c4716647-4716363 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|