Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 199823..200562 | Replicon | chromosome |
| Accession | NZ_LR890710 | ||
| Organism | Klebsiella pneumoniae isolate KSB2_9B | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4U9WP91 |
| Locus tag | JMX55_RS00980 | Protein ID | WP_004901283.1 |
| Coordinates | 200077..200562 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMX55_RS00975 | Protein ID | WP_003026799.1 |
| Coordinates | 199823..200089 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX55_RS00960 | 195325..197394 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
| JMX55_RS00965 | 197692..199061 | + | 1370 | WP_087661561.1 | IS3 family transposase | - |
| JMX55_RS00970 | 199262..199690 | + | 429 | WP_072001701.1 | GFA family protein | - |
| JMX55_RS00975 | 199823..200089 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX55_RS00980 | 200077..200562 | + | 486 | WP_004901283.1 | GNAT family N-acetyltransferase | Toxin |
| JMX55_RS00985 | 200887..201933 | - | 1047 | WP_071042611.1 | IS481-like element ISKpn28 family transposase | - |
| JMX55_RS00990 | 202007..202159 | + | 153 | WP_012967075.1 | type I toxin-antitoxin system toxin HokA | - |
| JMX55_RS00995 | 202461..204080 | + | 1620 | WP_040237813.1 | ATP-binding cassette domain-containing protein | - |
| JMX55_RS01000 | 204179..204391 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| JMX55_RS01005 | 204643..204933 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 198336..201933 | 3597 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17594.32 Da Isoelectric Point: 10.1788
>T291906 WP_004901283.1 NZ_LR890710:200077-200562 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLNQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLNQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U9WP91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |