Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 54962..55605 | Replicon | plasmid 2 |
Accession | NZ_LR890703 | ||
Organism | Klebsiella pneumoniae isolate INF305-sc-2280094 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A3A3ZBE4 |
Locus tag | JMX64_RS27345 | Protein ID | WP_007374381.1 |
Coordinates | 54962..55378 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | G8LQB1 |
Locus tag | JMX64_RS27350 | Protein ID | WP_007853351.1 |
Coordinates | 55375..55605 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX64_RS27320 | 50446..50784 | - | 339 | WP_007374386.1 | carboxymuconolactone decarboxylase family protein | - |
JMX64_RS27325 | 50801..51370 | - | 570 | WP_042936984.1 | TetR/AcrR family transcriptional regulator | - |
JMX64_RS27330 | 51554..52111 | - | 558 | WP_007374384.1 | OsmC family protein | - |
JMX64_RS27335 | 52320..53342 | - | 1023 | WP_007374383.1 | hypothetical protein | - |
JMX64_RS27340 | 53327..54889 | - | 1563 | WP_042936981.1 | AAA family ATPase | - |
JMX64_RS27345 | 54962..55378 | - | 417 | WP_007374381.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMX64_RS27350 | 55375..55605 | - | 231 | WP_007853351.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMX64_RS27355 | 56423..57658 | - | 1236 | WP_023288250.1 | RhtX/FptX family siderophore transporter | - |
JMX64_RS27360 | 57671..59122 | - | 1452 | WP_075917562.1 | PepSY domain-containing protein | - |
JMX64_RS27365 | 59080..59328 | - | 249 | WP_023288248.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..161308 | 161308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15105.57 Da Isoelectric Point: 7.8882
>T291898 WP_007374381.1 NZ_LR890703:c55378-54962 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGATGPKAAPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYAEMRFGATGPKAAPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A3ZBE4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A3Z894 |