Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4955581..4956200 Replicon chromosome
Accession NZ_LR890702
Organism Klebsiella pneumoniae isolate INF305-sc-2280094

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMX64_RS24420 Protein ID WP_002892050.1
Coordinates 4955581..4955799 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMX64_RS24425 Protein ID WP_002892066.1
Coordinates 4955826..4956200 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX64_RS24385 4951624..4951887 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
JMX64_RS24390 4951887..4952027 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMX64_RS24395 4952024..4952722 - 699 WP_004177238.1 GNAT family N-acetyltransferase -
JMX64_RS24400 4952823..4954274 + 1452 WP_064162152.1 PLP-dependent aminotransferase family protein -
JMX64_RS24405 4954249..4954719 - 471 WP_002892026.1 YlaC family protein -
JMX64_RS24410 4954740..4954880 + 141 WP_004147370.1 hypothetical protein -
JMX64_RS24415 4954852..4955418 - 567 WP_002892030.1 maltose O-acetyltransferase -
JMX64_RS24420 4955581..4955799 - 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMX64_RS24425 4955826..4956200 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMX64_RS24430 4956686..4959832 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMX64_RS24435 4959855..4961048 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291896 WP_002892050.1 NZ_LR890702:c4955799-4955581 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291896 WP_002892066.1 NZ_LR890702:c4956200-4955826 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References