Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 103930..104531 Replicon plasmid 2
Accession NZ_LR890694
Organism Escherichia coli isolate MSB1_4E-sc-2280348

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag JMW23_RS25180 Protein ID WP_001216034.1
Coordinates 104151..104531 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JMW23_RS25175 Protein ID WP_001190712.1
Coordinates 103930..104151 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW23_RS25155 99538..100533 + 996 WP_000246636.1 hypothetical protein -
JMW23_RS25160 100537..101469 + 933 WP_000991832.1 hypothetical protein -
JMW23_RS25165 101606..102303 - 698 Protein_120 IS1 family transposase -
JMW23_RS25170 102332..103747 - 1416 WP_100498477.1 type I restriction-modification system subunit M -
JMW23_RS25175 103930..104151 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW23_RS25180 104151..104531 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW23_RS25185 104536..104715 + 180 WP_001513661.1 hypothetical protein -
JMW23_RS25190 104743..105102 + 360 WP_001513660.1 hypothetical protein -
JMW23_RS25195 105026..105439 + 414 Protein_126 DDE-type integrase/transposase/recombinase -
JMW23_RS25200 105389..105706 - 318 WP_001513659.1 hypothetical protein -
JMW23_RS25205 105934..106950 - 1017 WP_012372828.1 IS5-like element IS5 family transposase -
JMW23_RS25210 107158..108561 + 1404 WP_001373486.1 S-methylmethionine permease -
JMW23_RS25215 108548..109480 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-27 senB 1..112822 112822
- inside IScluster/Tn - - 101606..110311 8705


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T291885 WP_001216034.1 NZ_LR890694:104151-104531 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT291885 WP_001190712.1 NZ_LR890694:103930-104151 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References