Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 98305..98830 | Replicon | plasmid 2 |
Accession | NZ_LR890694 | ||
Organism | Escherichia coli isolate MSB1_4E-sc-2280348 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | JMW23_RS25145 | Protein ID | WP_001159868.1 |
Coordinates | 98305..98610 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | JMW23_RS25150 | Protein ID | WP_000813634.1 |
Coordinates | 98612..98830 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW23_RS25130 | 94215..95381 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
JMW23_RS25135 | 95969..96724 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
JMW23_RS25140 | 97498..98304 | - | 807 | WP_000016982.1 | site-specific integrase | - |
JMW23_RS25145 | 98305..98610 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
JMW23_RS25150 | 98612..98830 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
JMW23_RS25155 | 99538..100533 | + | 996 | WP_000246636.1 | hypothetical protein | - |
JMW23_RS25160 | 100537..101469 | + | 933 | WP_000991832.1 | hypothetical protein | - |
JMW23_RS25165 | 101606..102303 | - | 698 | Protein_120 | IS1 family transposase | - |
JMW23_RS25170 | 102332..103747 | - | 1416 | WP_100498477.1 | type I restriction-modification system subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-27 | senB | 1..112822 | 112822 | |
- | inside | IScluster/Tn | - | - | 101606..110311 | 8705 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T291884 WP_001159868.1 NZ_LR890694:c98610-98305 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|