Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3996928..3997748 | Replicon | chromosome |
Accession | NZ_LR890693 | ||
Organism | Escherichia coli isolate MSB1_4E-sc-2280348 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | JMW23_RS19475 | Protein ID | WP_001054379.1 |
Coordinates | 3997491..3997748 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | JMW23_RS19470 | Protein ID | WP_000123957.1 |
Coordinates | 3996928..3997479 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW23_RS19440 | 3992622..3993935 | - | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
JMW23_RS19445 | 3993947..3994225 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
JMW23_RS19450 | 3994222..3995343 | - | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
JMW23_RS19455 | 3995588..3995704 | - | 117 | Protein_3801 | VOC family protein | - |
JMW23_RS19460 | 3995742..3996002 | - | 261 | WP_000077645.1 | hypothetical protein | - |
JMW23_RS19465 | 3996130..3996876 | - | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
JMW23_RS19470 | 3996928..3997479 | - | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
JMW23_RS19475 | 3997491..3997748 | - | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
JMW23_RS19480 | 3998125..3998289 | - | 165 | Protein_3806 | GNAT family N-acetyltransferase | - |
JMW23_RS19490 | 3999532..4000638 | + | 1107 | Protein_3808 | DNA helicase | - |
JMW23_RS19495 | 4001221..4002201 | - | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T291870 WP_001054379.1 NZ_LR890693:c3997748-3997491 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT291870 WP_000123957.1 NZ_LR890693:c3997479-3996928 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|