Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3964291..3965126 | Replicon | chromosome |
Accession | NZ_LR890693 | ||
Organism | Escherichia coli isolate MSB1_4E-sc-2280348 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | JMW23_RS19315 | Protein ID | WP_000854759.1 |
Coordinates | 3964749..3965126 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | JMW23_RS19310 | Protein ID | WP_001295723.1 |
Coordinates | 3964291..3964659 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW23_RS19285 | 3961406..3961564 | + | 159 | WP_001323397.1 | DUF905 family protein | - |
JMW23_RS19290 | 3961719..3962537 | + | 819 | WP_001234738.1 | DUF945 domain-containing protein | - |
JMW23_RS19295 | 3962879..3963352 | + | 474 | WP_001350782.1 | antirestriction protein | - |
JMW23_RS19300 | 3963368..3963844 | + | 477 | WP_001186775.1 | RadC family protein | - |
JMW23_RS19305 | 3963907..3964128 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
JMW23_RS19310 | 3964291..3964659 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW23_RS19315 | 3964749..3965126 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
JMW23_RS19320 | 3965123..3965611 | + | 489 | WP_000761690.1 | hypothetical protein | - |
JMW23_RS19325 | 3965628..3965804 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
JMW23_RS19330 | 3965904..3966062 | + | 159 | WP_001467148.1 | hypothetical protein | - |
JMW23_RS19335 | 3966426..3966602 | + | 177 | Protein_3777 | helix-turn-helix domain-containing protein | - |
JMW23_RS19340 | 3967375..3969015 | + | 1641 | WP_001332039.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3950596..3978082 | 27486 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T291869 WP_000854759.1 NZ_LR890693:3964749-3965126 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT291869 WP_001295723.1 NZ_LR890693:3964291-3964659 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |