Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 200737..201263 | Replicon | plasmid 2 |
Accession | NZ_LR890692 | ||
Organism | Klebsiella pneumoniae isolate INF119-sc-2279930 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | JMW99_RS26105 | Protein ID | WP_000323025.1 |
Coordinates | 200737..201024 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | JMW99_RS26110 | Protein ID | WP_000534858.1 |
Coordinates | 201024..201263 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW99_RS26060 | 195888..196208 | - | 321 | WP_004152720.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
JMW99_RS26065 | 196289..196513 | - | 225 | WP_004152719.1 | hypothetical protein | - |
JMW99_RS26070 | 196524..196736 | - | 213 | WP_004182070.1 | hypothetical protein | - |
JMW99_RS26075 | 196797..197153 | - | 357 | WP_004152717.1 | hypothetical protein | - |
JMW99_RS26080 | 197789..198139 | - | 351 | WP_004182068.1 | hypothetical protein | - |
JMW99_RS26085 | 198136..198408 | - | 273 | WP_004182067.1 | hypothetical protein | - |
JMW99_RS26090 | 199104..199265 | - | 162 | WP_004118124.1 | type I toxin-antitoxin system Hok family toxin | - |
JMW99_RS26095 | 199335..200393 | + | 1059 | WP_201524158.1 | IS481 family transposase | - |
JMW99_RS26100 | 200335..200853 | + | 519 | WP_135724303.1 | integrase core domain-containing protein | - |
JMW99_RS26105 | 200737..201024 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
JMW99_RS26110 | 201024..201263 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
JMW99_RS26115 | 201526..202449 | - | 924 | WP_020277922.1 | cation diffusion facilitator family transporter | - |
JMW99_RS26120 | 202649..203221 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
JMW99_RS26125 | 203697..204242 | - | 546 | Protein_211 | IS110 family transposase | - |
JMW99_RS26135 | 205843..206217 | - | 375 | WP_004182064.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 199335..205639 | 6304 | |
- | inside | Conjugative plasmid | - | - | 1..233443 | 233443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T291849 WP_000323025.1 NZ_LR890692:c201024-200737 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|