Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 95626..96362 | Replicon | plasmid 2 |
| Accession | NZ_LR890692 | ||
| Organism | Klebsiella pneumoniae isolate INF119-sc-2279930 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | JMW99_RS25525 | Protein ID | WP_004098919.1 |
| Coordinates | 95626..96108 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | JMW99_RS25530 | Protein ID | WP_032415032.1 |
| Coordinates | 96096..96362 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW99_RS25510 | 91527..93179 | + | 1653 | WP_032415028.1 | hypothetical protein | - |
| JMW99_RS25515 | 93218..94012 | - | 795 | WP_004187050.1 | tetratricopeptide repeat protein | - |
| JMW99_RS25520 | 94071..95417 | - | 1347 | WP_077254682.1 | ISNCY family transposase | - |
| JMW99_RS25525 | 95626..96108 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| JMW99_RS25530 | 96096..96362 | - | 267 | WP_032415032.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW99_RS25535 | 96708..97676 | + | 969 | WP_000654811.1 | IS5 family transposase | - |
| JMW99_RS25540 | 97930..98178 | + | 249 | WP_004187025.1 | plasmid stabilization protein | - |
| JMW99_RS25545 | 98168..98452 | + | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JMW99_RS25550 | 98468..98620 | - | 153 | WP_122985329.1 | hypothetical protein | - |
| JMW99_RS25560 | 99852..100229 | + | 378 | WP_004114613.1 | IS66 family insertion sequence hypothetical protein | - |
| JMW99_RS25565 | 100226..100573 | + | 348 | WP_004114612.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..233443 | 233443 | |
| - | inside | IScluster/Tn | - | - | 94071..102575 | 8504 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T291847 WP_004098919.1 NZ_LR890692:c96108-95626 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|