Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 148002..148753 | Replicon | plasmid 2 |
| Accession | NZ_LR890687 | ||
| Organism | Klebsiella pneumoniae isolate INF201-sc-2280069 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A071LQ79 |
| Locus tag | JMX24_RS26295 | Protein ID | WP_036114515.1 |
| Coordinates | 148002..148484 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | JMX24_RS26300 | Protein ID | WP_049095199.1 |
| Coordinates | 148475..148753 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX24_RS26275 | 144510..145913 | + | 1404 | WP_201616449.1 | glycoside hydrolase family 1 protein | - |
| JMX24_RS26280 | 146005..146367 | - | 363 | WP_117389542.1 | type II toxin-antitoxin system VapC family toxin | - |
| JMX24_RS26285 | 146526..146867 | - | 342 | Protein_155 | AAA family ATPase | - |
| JMX24_RS26290 | 146945..147869 | + | 925 | Protein_156 | IS5 family transposase | - |
| JMX24_RS26295 | 148002..148484 | - | 483 | WP_036114515.1 | GNAT family N-acetyltransferase | Toxin |
| JMX24_RS26300 | 148475..148753 | - | 279 | WP_049095199.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX24_RS26305 | 148875..149087 | - | 213 | WP_049095200.1 | hypothetical protein | - |
| JMX24_RS26310 | 149554..149880 | - | 327 | WP_075209941.1 | hypothetical protein | - |
| JMX24_RS26315 | 149924..150034 | + | 111 | Protein_161 | glutathione ABC transporter permease GsiC | - |
| JMX24_RS26320 | 150118..151788 | - | 1671 | WP_032413257.1 | AMP-binding protein | - |
| JMX24_RS26325 | 151769..153034 | - | 1266 | WP_048281137.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
| JMX24_RS26330 | 153052..153342 | - | 291 | WP_032413253.1 | MSMEG_0570 family nitrogen starvation response protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..169772 | 169772 | |
| - | flank | IS/Tn | - | - | 147054..147869 | 815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17694.45 Da Isoelectric Point: 8.9130
>T291832 WP_036114515.1 NZ_LR890687:c148484-148002 [Klebsiella pneumoniae]
MGMRAPESLTSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|