Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5206458..5207083 | Replicon | chromosome |
| Accession | NZ_LR890686 | ||
| Organism | Klebsiella pneumoniae isolate INF201-sc-2280069 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | JMX24_RS25145 | Protein ID | WP_002882817.1 |
| Coordinates | 5206458..5206841 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | JMX24_RS25150 | Protein ID | WP_004150355.1 |
| Coordinates | 5206841..5207083 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX24_RS25130 | 5203824..5204726 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| JMX24_RS25135 | 5204723..5205358 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMX24_RS25140 | 5205355..5206284 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| JMX24_RS25145 | 5206458..5206841 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX24_RS25150 | 5206841..5207083 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JMX24_RS25155 | 5207288..5208205 | + | 918 | WP_009484979.1 | alpha/beta hydrolase | - |
| JMX24_RS25160 | 5208219..5209160 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| JMX24_RS25165 | 5209205..5209642 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| JMX24_RS25170 | 5209639..5210499 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| JMX24_RS25175 | 5210493..5211092 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T291829 WP_002882817.1 NZ_LR890686:c5206841-5206458 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |