Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4729539..4730055 | Replicon | chromosome |
| Accession | NZ_LR890686 | ||
| Organism | Klebsiella pneumoniae isolate INF201-sc-2280069 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A2BGN7 |
| Locus tag | JMX24_RS22865 | Protein ID | WP_009486548.1 |
| Coordinates | 4729539..4729823 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMX24_RS22870 | Protein ID | WP_002886901.1 |
| Coordinates | 4729813..4730055 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX24_RS22840 | 4724956..4725264 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
| JMX24_RS22845 | 4725349..4725522 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| JMX24_RS22850 | 4725525..4726268 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| JMX24_RS22855 | 4726625..4728763 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMX24_RS22860 | 4729071..4729535 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMX24_RS22865 | 4729539..4729823 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX24_RS22870 | 4729813..4730055 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMX24_RS22875 | 4730133..4732043 | - | 1911 | WP_009486549.1 | BglG family transcription antiterminator | - |
| JMX24_RS22880 | 4732066..4733220 | - | 1155 | WP_020316350.1 | lactonase family protein | - |
| JMX24_RS22885 | 4733287..4734027 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T291827 WP_009486548.1 NZ_LR890686:c4729823-4729539 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A2BGN7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |