Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 807904..808561 | Replicon | chromosome |
Accession | NZ_LR890686 | ||
Organism | Klebsiella pneumoniae isolate INF201-sc-2280069 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | JMX24_RS03980 | Protein ID | WP_002916310.1 |
Coordinates | 808151..808561 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | JMX24_RS03975 | Protein ID | WP_002916312.1 |
Coordinates | 807904..808170 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX24_RS03950 | 803060..804493 | - | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
JMX24_RS03955 | 804612..805340 | - | 729 | WP_009485882.1 | MurR/RpiR family transcriptional regulator | - |
JMX24_RS03960 | 805390..805701 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
JMX24_RS03965 | 805865..806524 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
JMX24_RS03970 | 806675..807658 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
JMX24_RS03975 | 807904..808170 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
JMX24_RS03980 | 808151..808561 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
JMX24_RS03985 | 808568..809089 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
JMX24_RS03990 | 809190..810086 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
JMX24_RS03995 | 810109..810822 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
JMX24_RS04000 | 810828..812561 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T291819 WP_002916310.1 NZ_LR890686:808151-808561 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |