Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 58322..59079 | Replicon | plasmid 3 |
| Accession | NZ_LR890681 | ||
| Organism | Klebsiella pneumoniae isolate INF279-sc-2280202 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J4ZXV7 |
| Locus tag | JMX25_RS27600 | Protein ID | WP_029497408.1 |
| Coordinates | 58597..59079 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | JMX25_RS27595 | Protein ID | WP_094645258.1 |
| Coordinates | 58322..58609 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX25_RS27565 | 53685..53877 | - | 193 | Protein_61 | MFS transporter | - |
| JMX25_RS27570 | 53907..54884 | + | 978 | WP_004196334.1 | chromate resistance protein | - |
| JMX25_RS27575 | 54841..56217 | + | 1377 | WP_004196363.1 | chromate efflux transporter | - |
| JMX25_RS27580 | 56248..56937 | - | 690 | WP_004196322.1 | hypothetical protein | - |
| JMX25_RS27585 | 56951..57688 | - | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
| JMX25_RS27590 | 57732..58097 | - | 366 | WP_009651956.1 | hypothetical protein | - |
| JMX25_RS27595 | 58322..58609 | + | 288 | WP_094645258.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX25_RS27600 | 58597..59079 | + | 483 | WP_029497408.1 | GNAT family N-acetyltransferase | Toxin |
| JMX25_RS27605 | 59476..60168 | - | 693 | Protein_69 | IS3-like element ISKpn38 family transposase | - |
| JMX25_RS27610 | 60198..60554 | - | 357 | Protein_70 | transposase | - |
| JMX25_RS27615 | 60588..62126 | - | 1539 | WP_004196907.1 | IS66-like element ISEc22 family transposase | - |
| JMX25_RS27620 | 62175..62522 | - | 348 | WP_004196919.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| JMX25_RS27625 | 62519..62923 | - | 405 | WP_004196883.1 | IS66 family insertion sequence hypothetical protein | - |
| JMX25_RS27630 | 63005..63853 | - | 849 | Protein_74 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..71104 | 71104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17599.34 Da Isoelectric Point: 9.8719
>T291817 WP_029497408.1 NZ_LR890681:58597-59079 [Klebsiella pneumoniae]
VGRLTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLRLP
VGRLTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLRLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|