Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 21668..22193 Replicon plasmid 3
Accession NZ_LR890681
Organism Klebsiella pneumoniae isolate INF279-sc-2280202

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag JMX25_RS27375 Protein ID WP_013023785.1
Coordinates 21888..22193 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag JMX25_RS27370 Protein ID WP_001568025.1
Coordinates 21668..21886 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX25_RS27345 17794..18816 - 1023 WP_000361404.1 helicase UvrD -
JMX25_RS27350 18801..20363 - 1563 WP_009309907.1 AAA family ATPase -
JMX25_RS27355 20437..20853 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
JMX25_RS27360 20850..21080 - 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMX25_RS27365 21037..21498 + 462 WP_160866775.1 hypothetical protein -
JMX25_RS27370 21668..21886 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMX25_RS27375 21888..22193 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
JMX25_RS27380 22380..23384 + 1005 WP_029497484.1 hypothetical protein -
JMX25_RS27385 23582..24361 + 780 WP_029497485.1 site-specific integrase -
JMX25_RS27390 24419..24676 - 258 WP_000764642.1 hypothetical protein -
JMX25_RS27395 24805..24918 - 114 WP_012540012.1 hypothetical protein -
JMX25_RS27400 25552..26307 + 756 WP_012539983.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..71104 71104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T291816 WP_013023785.1 NZ_LR890681:21888-22193 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT291816 WP_001568025.1 NZ_LR890681:21668-21886 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References