Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5186181..5186806 | Replicon | chromosome |
| Accession | NZ_LR890679 | ||
| Organism | Klebsiella pneumoniae isolate INF279-sc-2280202 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | JMX25_RS25205 | Protein ID | WP_019705794.1 |
| Coordinates | 5186181..5186564 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | JMX25_RS25210 | Protein ID | WP_004150355.1 |
| Coordinates | 5186564..5186806 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX25_RS25190 | 5183547..5184449 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| JMX25_RS25195 | 5184446..5185081 | + | 636 | WP_032430299.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMX25_RS25200 | 5185078..5186007 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| JMX25_RS25205 | 5186181..5186564 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX25_RS25210 | 5186564..5186806 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JMX25_RS25215 | 5187011..5187928 | + | 918 | WP_032430300.1 | alpha/beta hydrolase | - |
| JMX25_RS25220 | 5187943..5188884 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| JMX25_RS25225 | 5188929..5189366 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| JMX25_RS25230 | 5189363..5190223 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| JMX25_RS25235 | 5190217..5190816 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T291813 WP_019705794.1 NZ_LR890679:c5186564-5186181 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |