Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4033901..4034520 Replicon chromosome
Accession NZ_LR890679
Organism Klebsiella pneumoniae isolate INF279-sc-2280202

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMX25_RS19845 Protein ID WP_002892050.1
Coordinates 4034302..4034520 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMX25_RS19840 Protein ID WP_002892066.1
Coordinates 4033901..4034275 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX25_RS19830 4029053..4030246 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMX25_RS19835 4030269..4033415 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit -
JMX25_RS19840 4033901..4034275 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMX25_RS19845 4034302..4034520 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMX25_RS19850 4034679..4035245 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMX25_RS19855 4035217..4035357 - 141 WP_004147370.1 hypothetical protein -
JMX25_RS19860 4035378..4035848 + 471 WP_002892026.1 YlaC family protein -
JMX25_RS19865 4035823..4037274 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMX25_RS19870 4037375..4038073 + 699 WP_040220001.1 GNAT family N-acetyltransferase -
JMX25_RS19875 4038070..4038210 - 141 WP_040219999.1 type B 50S ribosomal protein L36 -
JMX25_RS19880 4038210..4038473 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291809 WP_002892050.1 NZ_LR890679:4034302-4034520 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291809 WP_002892066.1 NZ_LR890679:4033901-4034275 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References