Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 736952..737709 | Replicon | chromosome |
Accession | NZ_LR890679 | ||
Organism | Klebsiella pneumoniae isolate INF279-sc-2280202 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A1D8JMF4 |
Locus tag | JMX25_RS03650 | Protein ID | WP_044159004.1 |
Coordinates | 737227..737709 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A1D8JMH3 |
Locus tag | JMX25_RS03645 | Protein ID | WP_007372584.1 |
Coordinates | 736952..737236 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX25_RS03625 | 732344..733066 | + | 723 | WP_013095151.1 | TIGR03761 family integrating conjugative element protein | - |
JMX25_RS03630 | 733084..735096 | + | 2013 | WP_044159002.1 | DNA topoisomerase III | - |
JMX25_RS03635 | 735729..736220 | + | 492 | WP_007372582.1 | DUF3577 domain-containing protein | - |
JMX25_RS03640 | 736296..736796 | + | 501 | WP_007372583.1 | single-stranded DNA-binding protein | - |
JMX25_RS03645 | 736952..737236 | + | 285 | WP_007372584.1 | DUF1778 domain-containing protein | Antitoxin |
JMX25_RS03650 | 737227..737709 | + | 483 | WP_044159004.1 | GNAT family N-acetyltransferase | Toxin |
JMX25_RS03655 | 737942..739228 | + | 1287 | WP_013095156.1 | TcpQ domain-containing protein | - |
JMX25_RS03660 | 739230..739673 | + | 444 | WP_007372587.1 | type IV pilus biogenesis protein PilM | - |
JMX25_RS03665 | 739693..741366 | + | 1674 | WP_013095157.1 | PilN family type IVB pilus formation outer membrane protein | - |
JMX25_RS03670 | 741369..742649 | + | 1281 | WP_176682058.1 | type 4b pilus protein PilO2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 724822..832258 | 107436 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17693.32 Da Isoelectric Point: 6.9570
>T291802 WP_044159004.1 NZ_LR890679:737227-737709 [Klebsiella pneumoniae]
MEINVTAPALLTEEHVLHSFDCGNAVLDDWLRRRALKNQHLNASRTFVICPEGTACVVGYYSLATGSVSHVDLSRSLRQN
MPDPVPVVLLGRLAVDVSTQGNNFGKWLLNDAVMRVSNLADQVGIKAIMVHAIDERAKAFYEYFGFVQSPVAANTLFYKI
MEINVTAPALLTEEHVLHSFDCGNAVLDDWLRRRALKNQHLNASRTFVICPEGTACVVGYYSLATGSVSHVDLSRSLRQN
MPDPVPVVLLGRLAVDVSTQGNNFGKWLLNDAVMRVSNLADQVGIKAIMVHAIDERAKAFYEYFGFVQSPVAANTLFYKI
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D8JMF4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D8JMH3 |