Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 61612..62348 | Replicon | plasmid 3 |
Accession | NZ_LR890671 | ||
Organism | Klebsiella pneumoniae isolate INF321-sc-2280120 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | JMW44_RS25770 | Protein ID | WP_003026803.1 |
Coordinates | 61866..62348 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMW44_RS25765 | Protein ID | WP_003026799.1 |
Coordinates | 61612..61878 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW44_RS25745 | 58311..58619 | - | 309 | WP_017896554.1 | hypothetical protein | - |
JMW44_RS25755 | 60338..60886 | + | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
JMW44_RS25760 | 60933..61367 | + | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
JMW44_RS25765 | 61612..61878 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMW44_RS25770 | 61866..62348 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
JMW44_RS25780 | 64146..64907 | - | 762 | WP_201507409.1 | DUF945 domain-containing protein | - |
JMW44_RS25785 | 65735..66148 | - | 414 | WP_021312979.1 | helix-turn-helix domain-containing protein | - |
JMW44_RS25790 | 66149..66427 | - | 279 | WP_004152721.1 | helix-turn-helix domain-containing protein | - |
JMW44_RS25795 | 66417..66737 | - | 321 | WP_004152720.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
JMW44_RS25800 | 66818..67042 | - | 225 | WP_014343499.1 | hypothetical protein | - |
JMW44_RS25805 | 67053..67265 | - | 213 | WP_019706020.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..115932 | 115932 | |
- | inside | IScluster/Tn | - | - | 54993..64101 | 9108 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T291797 WP_003026803.1 NZ_LR890671:61866-62348 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |