Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 15323..15966 Replicon plasmid 3
Accession NZ_LR890671
Organism Klebsiella pneumoniae isolate INF321-sc-2280120

Toxin (Protein)


Gene name vagD Uniprot ID A0A3Q8D6L7
Locus tag JMW44_RS25525 Protein ID WP_020804312.1
Coordinates 15550..15966 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag JMW44_RS25520 Protein ID WP_001261276.1
Coordinates 15323..15553 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW44_RS25480 10863..10976 + 114 WP_014343462.1 hypothetical protein -
JMW44_RS25485 11105..11362 + 258 WP_009310077.1 hypothetical protein -
JMW44_RS25490 11420..12199 - 780 WP_023287113.1 site-specific integrase -
JMW44_RS25495 12397..13413 - 1017 WP_009309921.1 hypothetical protein -
JMW44_RS25500 13447..13782 - 336 WP_009309920.1 hypothetical protein -
JMW44_RS25505 13832..13972 - 141 WP_162898808.1 hypothetical protein -
JMW44_RS25510 14201..14506 - 306 WP_009309918.1 type II toxin-antitoxin system toxin CcdB -
JMW44_RS25515 14508..14726 - 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA -
JMW44_RS25520 15323..15553 + 231 WP_001261276.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW44_RS25525 15550..15966 + 417 WP_020804312.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW44_RS25530 16007..16885 - 879 WP_009309916.1 restriction endonuclease -
JMW44_RS25535 17547..18584 + 1038 Protein_22 HlyD family secretion protein -
JMW44_RS25540 18713..19693 - 981 WP_009310076.1 IS5-like element ISKpn26 family transposase -
JMW44_RS25545 19920..20856 + 937 Protein_24 CAAX protease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..115932 115932
- inside IScluster/Tn - - 18713..27014 8301


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15154.59 Da        Isoelectric Point: 7.8637

>T291795 WP_020804312.1 NZ_LR890671:15550-15966 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPESVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT291795 WP_001261276.1 NZ_LR890671:15323-15553 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Q8D6L7

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References