Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3832265..3832884 Replicon chromosome
Accession NZ_LR890669
Organism Klebsiella pneumoniae isolate INF321-sc-2280120

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW44_RS18710 Protein ID WP_002892050.1
Coordinates 3832666..3832884 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW44_RS18705 Protein ID WP_002892066.1
Coordinates 3832265..3832639 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW44_RS18695 3827417..3828610 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW44_RS18700 3828633..3831779 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW44_RS18705 3832265..3832639 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW44_RS18710 3832666..3832884 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW44_RS18715 3833047..3833613 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW44_RS18720 3833585..3833725 - 141 WP_004147370.1 hypothetical protein -
JMW44_RS18725 3833746..3834216 + 471 WP_002892026.1 YlaC family protein -
JMW44_RS18730 3834191..3835642 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMW44_RS18735 3835743..3836441 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
JMW44_RS18740 3836438..3836578 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW44_RS18745 3836578..3836841 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291789 WP_002892050.1 NZ_LR890669:3832666-3832884 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291789 WP_002892066.1 NZ_LR890669:3832265-3832639 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References