Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 714020..714795 | Replicon | chromosome |
Accession | NZ_LR890669 | ||
Organism | Klebsiella pneumoniae isolate INF321-sc-2280120 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B6ZBI6 |
Locus tag | JMW44_RS03560 | Protein ID | WP_004889762.1 |
Coordinates | 714310..714795 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | JMW44_RS03555 | Protein ID | WP_004150912.1 |
Coordinates | 714020..714313 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW44_RS03535 | 709228..709830 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
JMW44_RS03540 | 709928..710839 | + | 912 | WP_021314148.1 | LysR family transcriptional regulator | - |
JMW44_RS03545 | 710840..711988 | - | 1149 | WP_064179254.1 | PLP-dependent aspartate aminotransferase family protein | - |
JMW44_RS03550 | 711999..713375 | - | 1377 | WP_004181304.1 | cystathionine beta-synthase | - |
JMW44_RS03555 | 714020..714313 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
JMW44_RS03560 | 714310..714795 | + | 486 | WP_004889762.1 | GNAT family N-acetyltransferase | Toxin |
JMW44_RS03565 | 714974..715426 | - | 453 | WP_080816334.1 | hypothetical protein | - |
JMW44_RS03570 | 715931..718216 | - | 2286 | WP_064179256.1 | hypothetical protein | - |
JMW44_RS03575 | 718345..718582 | - | 238 | Protein_702 | hypothetical protein | - |
JMW44_RS03580 | 718616..719584 | + | 969 | WP_077255423.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 718661..719584 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17585.56 Da Isoelectric Point: 8.5144
>T291781 WP_004889762.1 NZ_LR890669:714310-714795 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A447W563 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |