Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 225690..226600 Replicon plasmid 2
Accession NZ_LR890666
Organism Klebsiella pneumoniae isolate INF065-sc-2279980

Toxin (Protein)


Gene name - Uniprot ID R4YBC5
Locus tag JMX32_RS26805 Protein ID WP_004144067.1
Coordinates 225690..226160 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag JMX32_RS26810 Protein ID WP_004026357.1
Coordinates 226157..226600 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX32_RS26770 221001..221267 - 267 WP_003026799.1 DUF1778 domain-containing protein -
JMX32_RS26775 221400..221828 - 429 WP_004901287.1 GFA family protein -
JMX32_RS26780 222029..222175 - 147 WP_159193595.1 IS3 family transposase -
JMX32_RS26785 222197..223317 + 1121 WP_101837575.1 IS3 family transposase -
JMX32_RS26790 223344..224159 - 816 WP_077268817.1 IS3 family transposase -
JMX32_RS26795 224114..224623 - 510 WP_004901294.1 IS3 family transposase -
JMX32_RS26800 225319..225579 + 261 WP_048291871.1 hypothetical protein -
JMX32_RS26805 225690..226160 - 471 WP_004144067.1 RES family NAD+ phosphorylase Toxin
JMX32_RS26810 226157..226600 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
JMX32_RS26815 226701..227207 - 507 Protein_213 DUF4113 domain-containing protein -
JMX32_RS26820 227308..227529 - 222 WP_072060588.1 DUF2188 domain-containing protein -
JMX32_RS26825 227953..228690 + 738 Protein_215 DUF1311 domain-containing protein -
JMX32_RS26830 228690..229031 + 342 WP_048291869.1 hypothetical protein -
JMX32_RS26835 229426..230471 + 1046 Protein_217 IS3 family transposase -
JMX32_RS26840 230526..230900 + 375 WP_173675457.1 hypothetical protein -
JMX32_RS26845 230830..231054 + 225 WP_127807699.1 DUF4113 domain-containing protein -
JMX32_RS26850 231133..231361 + 229 Protein_220 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA 1..235594 235594
- flank IS/Tn - - 229773..230471 698


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17573.83 Da        Isoelectric Point: 4.5152

>T291778 WP_004144067.1 NZ_LR890666:c226160-225690 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT291778 WP_004026357.1 NZ_LR890666:c226600-226157 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A384IED8

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References