Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 220528..221267 | Replicon | plasmid 2 |
| Accession | NZ_LR890666 | ||
| Organism | Klebsiella pneumoniae isolate INF065-sc-2279980 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | JMX32_RS26765 | Protein ID | WP_021312536.1 |
| Coordinates | 220528..221013 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMX32_RS26770 | Protein ID | WP_003026799.1 |
| Coordinates | 221001..221267 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX32_RS26735 | 215672..216109 | - | 438 | WP_126034224.1 | hypothetical protein | - |
| JMX32_RS26740 | 216205..217272 | - | 1068 | WP_048291875.1 | hypothetical protein | - |
| JMX32_RS26745 | 217341..217637 | - | 297 | WP_048291874.1 | hypothetical protein | - |
| JMX32_RS26750 | 217871..218248 | + | 378 | WP_032719541.1 | hypothetical protein | - |
| JMX32_RS26755 | 218445..219419 | - | 975 | WP_048291873.1 | hypothetical protein | - |
| JMX32_RS26760 | 220024..220185 | - | 162 | WP_004118124.1 | type I toxin-antitoxin system Hok family toxin | - |
| JMX32_RS26765 | 220528..221013 | - | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
| JMX32_RS26770 | 221001..221267 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX32_RS26775 | 221400..221828 | - | 429 | WP_004901287.1 | GFA family protein | - |
| JMX32_RS26780 | 222029..222175 | - | 147 | WP_159193595.1 | IS3 family transposase | - |
| JMX32_RS26785 | 222197..223317 | + | 1121 | WP_101837575.1 | IS3 family transposase | - |
| JMX32_RS26790 | 223344..224159 | - | 816 | WP_077268817.1 | IS3 family transposase | - |
| JMX32_RS26795 | 224114..224623 | - | 510 | WP_004901294.1 | IS3 family transposase | - |
| JMX32_RS26800 | 225319..225579 | + | 261 | WP_048291871.1 | hypothetical protein | - |
| JMX32_RS26805 | 225690..226160 | - | 471 | WP_004144067.1 | RES family NAD+ phosphorylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA | 1..235594 | 235594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T291777 WP_021312536.1 NZ_LR890666:c221013-220528 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|