Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 183383..183908 Replicon plasmid 2
Accession NZ_LR890666
Organism Klebsiella pneumoniae isolate INF065-sc-2279980

Toxin (Protein)


Gene name ccdB Uniprot ID J5VBT8
Locus tag JMX32_RS26585 Protein ID WP_004197633.1
Coordinates 183603..183908 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID R4WC25
Locus tag JMX32_RS26580 Protein ID WP_015632547.1
Coordinates 183383..183601 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX32_RS26555 178809..179393 - 585 WP_023345591.1 TetR/AcrR family transcriptional regulator -
JMX32_RS26560 179505..179900 - 396 WP_023345592.1 helix-turn-helix transcriptional regulator -
JMX32_RS26565 180003..180848 + 846 WP_023345593.1 SDR family oxidoreductase -
JMX32_RS26570 180961..181389 + 429 WP_023345594.1 nuclear transport factor 2 family protein -
JMX32_RS26575 181731..183104 - 1374 WP_048265005.1 hypothetical protein -
JMX32_RS26580 183383..183601 + 219 WP_015632547.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMX32_RS26585 183603..183908 + 306 WP_004197633.1 type II toxin-antitoxin system toxin CcdB Toxin
JMX32_RS26590 184095..185083 + 989 Protein_168 hypothetical protein -
JMX32_RS26595 185282..186067 + 786 WP_048291886.1 site-specific integrase -
JMX32_RS26600 186389..186694 - 306 WP_126034233.1 hypothetical protein -
JMX32_RS26605 186843..187220 - 378 WP_158672279.1 DUF1173 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA 1..235594 235594


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11585.27 Da        Isoelectric Point: 6.4661

>T291776 WP_004197633.1 NZ_LR890666:183603-183908 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7247

>AT291776 WP_015632547.1 NZ_LR890666:183383-183601 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIDMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MCG5

Antitoxin

Source ID Structure
AlphaFold DB A0A2L1KT86

References