Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 176838..177481 Replicon plasmid 2
Accession NZ_LR890666
Organism Klebsiella pneumoniae isolate INF065-sc-2279980

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag JMX32_RS26540 Protein ID WP_023345587.1
Coordinates 176838..177254 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag JMX32_RS26545 Protein ID WP_023345588.1
Coordinates 177251..177481 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX32_RS26520 172225..172860 - 636 WP_023345584.1 DUF1349 domain-containing protein -
JMX32_RS26525 172899..174104 - 1206 WP_077258347.1 MFS transporter -
JMX32_RS26530 174189..174959 + 771 WP_023345582.1 helix-turn-helix transcriptional regulator -
JMX32_RS26535 175343..176746 + 1404 WP_142667906.1 family 1 glycosylhydrolase -
JMX32_RS26540 176838..177254 - 417 WP_023345587.1 type II toxin-antitoxin system VapC family toxin Toxin
JMX32_RS26545 177251..177481 - 231 WP_023345588.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMX32_RS26550 177899..178741 - 843 WP_048291887.1 nitroreductase family protein -
JMX32_RS26555 178809..179393 - 585 WP_023345591.1 TetR/AcrR family transcriptional regulator -
JMX32_RS26560 179505..179900 - 396 WP_023345592.1 helix-turn-helix transcriptional regulator -
JMX32_RS26565 180003..180848 + 846 WP_023345593.1 SDR family oxidoreductase -
JMX32_RS26570 180961..181389 + 429 WP_023345594.1 nuclear transport factor 2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA 1..235594 235594


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-48)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15082.55 Da        Isoelectric Point: 7.8644

>T291775 WP_023345587.1 NZ_LR890666:c177254-176838 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLMLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT291775 WP_023345588.1 NZ_LR890666:c177481-177251 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFAP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References