Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 162322..163126 | Replicon | plasmid 2 |
Accession | NZ_LR890666 | ||
Organism | Klebsiella pneumoniae isolate INF065-sc-2279980 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | JMX32_RS26475 | Protein ID | WP_072198182.1 |
Coordinates | 162599..163126 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | - |
Locus tag | JMX32_RS26470 | Protein ID | WP_048264996.1 |
Coordinates | 162322..162591 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX32_RS26460 | 158975..160222 | - | 1248 | WP_048264960.1 | nucleotidyltransferase | - |
JMX32_RS26465 | 160219..161394 | - | 1176 | WP_077258344.1 | SAVED domain-containing protein | - |
JMX32_RS26470 | 162322..162591 | + | 270 | WP_048264996.1 | DUF1778 domain-containing protein | Antitoxin |
JMX32_RS26475 | 162599..163126 | + | 528 | WP_072198182.1 | GNAT family N-acetyltransferase | Toxin |
JMX32_RS26480 | 163210..163518 | + | 309 | WP_064167953.1 | hypothetical protein | - |
JMX32_RS26485 | 163569..164266 | + | 698 | Protein_147 | IS1 family transposase | - |
JMX32_RS26490 | 164578..165480 | - | 903 | WP_048265000.1 | LysR family transcriptional regulator | - |
JMX32_RS26495 | 165578..166186 | + | 609 | WP_023345578.1 | short chain dehydrogenase | - |
JMX32_RS26500 | 166305..167486 | - | 1182 | WP_023345579.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA | 1..235594 | 235594 | |
- | flank | IS/Tn | - | - | 163763..164266 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 20078.04 Da Isoelectric Point: 5.7389
>T291774 WP_072198182.1 NZ_LR890666:162599-163126 [Klebsiella pneumoniae]
VMQELAIEMINDEFDYDIGEFDCGEETLNTFLKDHLKRQHDGQILKGYVLVTKEQKPKLLGYYTLSGSCFERKMLPSKTQ
QRKIPYQNAPSITLGRLAIDKSIQGQGWGELLVTHAMNVVWDASKAVGIYGLFVEALNDKAKRFYTRLDFIQLVGENSNL
LFYPTKSIEKIFTEE
VMQELAIEMINDEFDYDIGEFDCGEETLNTFLKDHLKRQHDGQILKGYVLVTKEQKPKLLGYYTLSGSCFERKMLPSKTQ
QRKIPYQNAPSITLGRLAIDKSIQGQGWGELLVTHAMNVVWDASKAVGIYGLFVEALNDKAKRFYTRLDFIQLVGENSNL
LFYPTKSIEKIFTEE
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|