Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 22391..23142 | Replicon | plasmid 2 |
Accession | NZ_LR890666 | ||
Organism | Klebsiella pneumoniae isolate INF065-sc-2279980 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A6P1V716 |
Locus tag | JMX32_RS25880 | Protein ID | WP_048978473.1 |
Coordinates | 22660..23142 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A6P1V8A4 |
Locus tag | JMX32_RS25875 | Protein ID | WP_048978474.1 |
Coordinates | 22391..22669 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX32_RS25860 | 19526..19984 | + | 459 | WP_173675456.1 | hypothetical protein | - |
JMX32_RS25865 | 20227..20541 | - | 315 | WP_040210113.1 | hypothetical protein | - |
JMX32_RS25870 | 21547..22083 | - | 537 | WP_048978475.1 | hypothetical protein | - |
JMX32_RS25875 | 22391..22669 | + | 279 | WP_048978474.1 | DUF1778 domain-containing protein | Antitoxin |
JMX32_RS25880 | 22660..23142 | + | 483 | WP_048978473.1 | GNAT family N-acetyltransferase | Toxin |
JMX32_RS25885 | 23180..23584 | + | 405 | WP_004210282.1 | DUF2251 domain-containing protein | - |
JMX32_RS25890 | 24349..25821 | + | 1473 | WP_077268816.1 | conjugative transfer system coupling protein TraD | - |
JMX32_RS25895 | 25814..26572 | + | 759 | WP_063445087.1 | TIGR03747 family integrating conjugative element membrane protein | - |
JMX32_RS25900 | 26657..27343 | - | 687 | WP_048330700.1 | hypothetical protein | - |
JMX32_RS25905 | 27535..27882 | + | 348 | WP_048330699.1 | hypothetical protein | - |
JMX32_RS25910 | 27882..28124 | + | 243 | WP_003029734.1 | TIGR03758 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ybtS / ybtX / ybtQ / ybtP / ybtA / irp2 / irp1 / ybtU / ybtT / ybtE / fyuA | 1..235594 | 235594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17763.69 Da Isoelectric Point: 9.4946
>T291773 WP_048978473.1 NZ_LR890666:22660-23142 [Klebsiella pneumoniae]
MGLRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGLRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P1V716 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P1V8A4 |