Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4038013..4038632 Replicon chromosome
Accession NZ_LR890665
Organism Klebsiella pneumoniae isolate INF065-sc-2279980

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMX32_RS19660 Protein ID WP_002892050.1
Coordinates 4038414..4038632 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMX32_RS19655 Protein ID WP_002892066.1
Coordinates 4038013..4038387 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX32_RS19645 4033165..4034358 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMX32_RS19650 4034381..4037527 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMX32_RS19655 4038013..4038387 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMX32_RS19660 4038414..4038632 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMX32_RS19665 4038791..4039357 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMX32_RS19670 4039329..4039469 - 141 WP_004147370.1 hypothetical protein -
JMX32_RS19675 4039490..4039960 + 471 WP_002892026.1 YlaC family protein -
JMX32_RS19680 4039935..4041386 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMX32_RS19685 4041487..4042185 + 699 WP_032414604.1 GNAT family N-acetyltransferase -
JMX32_RS19690 4042182..4042322 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMX32_RS19695 4042322..4042585 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291768 WP_002892050.1 NZ_LR890665:4038414-4038632 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291768 WP_002892066.1 NZ_LR890665:4038013-4038387 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References