Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 206423..207162 | Replicon | chromosome |
| Accession | NZ_LR890665 | ||
| Organism | Klebsiella pneumoniae isolate INF065-sc-2279980 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | JMX32_RS01000 | Protein ID | WP_021312536.1 |
| Coordinates | 206677..207162 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMX32_RS00995 | Protein ID | WP_003026799.1 |
| Coordinates | 206423..206689 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX32_RS00980 | 201926..203995 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
| JMX32_RS00985 | 204292..205661 | + | 1370 | WP_087830479.1 | IS3 family transposase | - |
| JMX32_RS00990 | 205862..206290 | + | 429 | WP_004901287.1 | GFA family protein | - |
| JMX32_RS00995 | 206423..206689 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX32_RS01000 | 206677..207162 | + | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
| JMX32_RS01005 | 207506..207658 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| JMX32_RS01010 | 207960..209579 | + | 1620 | WP_032415799.1 | ATP-binding cassette domain-containing protein | - |
| JMX32_RS01015 | 209678..209890 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| JMX32_RS01020 | 210143..210433 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| JMX32_RS01025 | 210679..212034 | - | 1356 | WP_064179508.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 204936..205661 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T291759 WP_021312536.1 NZ_LR890665:206677-207162 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|