Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 37536..38272 | Replicon | plasmid 3 |
| Accession | NZ_LR890659 | ||
| Organism | Serratia marcescens isolate MSB1_9C-sc-2280320 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | JMX15_RS27790 | Protein ID | WP_004098919.1 |
| Coordinates | 37536..38018 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A2J5Q9C0 |
| Locus tag | JMX15_RS27795 | Protein ID | WP_004098921.1 |
| Coordinates | 38006..38272 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX15_RS27775 | 34996..35775 | - | 780 | WP_004118708.1 | DUF1837 domain-containing protein | - |
| JMX15_RS27780 | 35851..36654 | - | 804 | WP_032724439.1 | TIGR02391 family protein | - |
| JMX15_RS27785 | 36676..37155 | - | 480 | Protein_37 | hypothetical protein | - |
| JMX15_RS27790 | 37536..38018 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| JMX15_RS27795 | 38006..38272 | - | 267 | WP_004098921.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX15_RS27800 | 38448..38702 | - | 255 | WP_004118702.1 | hypothetical protein | - |
| JMX15_RS27805 | 38778..39035 | - | 258 | WP_004098928.1 | hypothetical protein | - |
| JMX15_RS27810 | 39084..39287 | - | 204 | WP_004098931.1 | hemolysin expression modulator Hha | - |
| JMX15_RS27815 | 39318..39650 | - | 333 | WP_201621545.1 | hypothetical protein | - |
| JMX15_RS27820 | 39726..40694 | - | 969 | WP_077254959.1 | IS5 family transposase | - |
| JMX15_RS27825 | 40765..41445 | + | 681 | WP_004118655.1 | copper/silver response regulator transcription factor SilR | - |
| JMX15_RS27830 | 41438..42913 | + | 1476 | WP_004118652.1 | copper/silver sensor histidine kinase SilS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkA | 1..147079 | 147079 | |
| - | flank | IS/Tn | - | - | 39726..40694 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T291757 WP_004098919.1 NZ_LR890659:c38018-37536 [Serratia marcescens]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q9C0 |