Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4130664..4131320 | Replicon | chromosome |
| Accession | NZ_LR890657 | ||
| Organism | Serratia marcescens isolate MSB1_9C-sc-2280320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A5C7DE55 |
| Locus tag | JMX15_RS19865 | Protein ID | WP_047730091.1 |
| Coordinates | 4130664..4131053 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
| Locus tag | JMX15_RS19870 | Protein ID | WP_004941563.1 |
| Coordinates | 4131057..4131320 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX15_RS19850 | 4127133..4128563 | + | 1431 | WP_047730094.1 | MFS transporter | - |
| JMX15_RS19855 | 4128560..4129933 | + | 1374 | WP_055312308.1 | two-component system sensor histidine kinase BaeS | - |
| JMX15_RS19860 | 4129943..4130659 | + | 717 | WP_047730092.1 | two-component system response regulator BaeR | - |
| JMX15_RS19865 | 4130664..4131053 | - | 390 | WP_047730091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX15_RS19870 | 4131057..4131320 | - | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX15_RS19875 | 4131659..4131997 | + | 339 | WP_038873760.1 | YegP family protein | - |
| JMX15_RS19880 | 4132299..4133651 | + | 1353 | WP_038873761.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
| JMX15_RS19885 | 4133801..4134832 | - | 1032 | WP_001395480.1 | IS630-like element ISEc33 family transposase | - |
| JMX15_RS19890 | 4135274..4136179 | + | 906 | WP_038873764.1 | lipid kinase YegS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4133801..4134352 | 551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14337.57 Da Isoelectric Point: 7.8794
>T291753 WP_047730091.1 NZ_LR890657:c4131053-4130664 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|