Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3398310..3398941 | Replicon | chromosome |
| Accession | NZ_LR890657 | ||
| Organism | Serratia marcescens isolate MSB1_9C-sc-2280320 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A5P6GW52 |
| Locus tag | JMX15_RS16530 | Protein ID | WP_047730458.1 |
| Coordinates | 3398310..3398708 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JMX15_RS16535 | Protein ID | WP_201621361.1 |
| Coordinates | 3398708..3398941 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX15_RS16510 | 3393413..3394228 | - | 816 | WP_055313115.1 | 5'-nucleotidase, lipoprotein e(P4) family | - |
| JMX15_RS16515 | 3394557..3394961 | - | 405 | WP_055315478.1 | flagellar protein FlhE | - |
| JMX15_RS16520 | 3394961..3397039 | - | 2079 | WP_038876828.1 | flagellar biosynthesis protein FlhA | - |
| JMX15_RS16525 | 3397032..3398183 | - | 1152 | WP_047730459.1 | flagellar type III secretion system protein FlhB | - |
| JMX15_RS16530 | 3398310..3398708 | - | 399 | WP_047730458.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMX15_RS16535 | 3398708..3398941 | - | 234 | WP_201621361.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMX15_RS16540 | 3399067..3399711 | - | 645 | WP_004934858.1 | protein phosphatase CheZ | - |
| JMX15_RS16545 | 3399722..3400111 | - | 390 | WP_004934862.1 | chemotaxis response regulator CheY | - |
| JMX15_RS16550 | 3400214..3401263 | - | 1050 | WP_015378262.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| JMX15_RS16555 | 3401263..3402135 | - | 873 | WP_025159837.1 | protein-glutamate O-methyltransferase CheR | - |
| JMX15_RS16560 | 3402173..3403789 | - | 1617 | WP_047730456.1 | Tar ligand binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14960.14 Da Isoelectric Point: 7.4664
>T291752 WP_047730458.1 NZ_LR890657:c3398708-3398310 [Serratia marcescens]
MFSHMLDTNIVIYVIKRRPLEVLEVFNRYAGKMVISSITYGELVHGVENSARPAVNARVVEDFVSRLDILDYSAKAASHY
GNIRAVLERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVEGLRLENWL
MFSHMLDTNIVIYVIKRRPLEVLEVFNRYAGKMVISSITYGELVHGVENSARPAVNARVVEDFVSRLDILDYSAKAASHY
GNIRAVLERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVEGLRLENWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|