Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1187534..1188156 Replicon chromosome
Accession NZ_LR890657
Organism Serratia marcescens isolate MSB1_9C-sc-2280320

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag JMX15_RS05550 Protein ID WP_004940313.1
Coordinates 1187534..1187737 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag JMX15_RS05555 Protein ID WP_004940312.1
Coordinates 1187788..1188156 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX15_RS05530 1183301..1183663 - 363 WP_055313419.1 type II secretion system pilot lipoprotein GspS -
JMX15_RS05535 1183916..1185358 + 1443 WP_201621454.1 N-acetylglucosamine-binding protein GbpA -
JMX15_RS05545 1186732..1187250 + 519 WP_047728667.1 cytochrome b/b6 domain-containing protein -
JMX15_RS05550 1187534..1187737 - 204 WP_004940313.1 hemolysin expression modulator Hha Toxin
JMX15_RS05555 1187788..1188156 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
JMX15_RS05560 1188315..1188668 - 354 WP_038874974.1 hypothetical protein -
JMX15_RS05565 1189078..1189791 + 714 WP_055312214.1 ABC transporter ATP-binding protein -
JMX15_RS05570 1189788..1190645 + 858 WP_038874980.1 metal ABC transporter permease -
JMX15_RS05575 1190671..1191549 + 879 WP_055312213.1 zinc ABC transporter substrate-binding protein -
JMX15_RS05580 1191656..1191796 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
JMX15_RS05585 1191809..1192063 - 255 WP_038874985.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T291746 WP_004940313.1 NZ_LR890657:c1187737-1187534 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT291746 WP_004940312.1 NZ_LR890657:c1188156-1187788 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References