Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 181662..182287 | Replicon | plasmid 2 |
Accession | NZ_LR890652 | ||
Organism | Escherichia coli isolate MINF_2E-sc-2280463 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JMW95_RS24885 | Protein ID | WP_000911313.1 |
Coordinates | 181889..182287 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | JMW95_RS24880 | Protein ID | WP_000450520.1 |
Coordinates | 181662..181889 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW95_RS24880 | 181662..181889 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
JMW95_RS24885 | 181889..182287 | + | 399 | WP_000911313.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
JMW95_RS24890 | 182296..184521 | - | 2226 | WP_064237182.1 | type IV conjugative transfer system coupling protein TraD | - |
JMW95_RS24895 | 184774..185505 | - | 732 | WP_023565183.1 | complement resistance protein TraT | - |
JMW95_RS24900 | 185537..186034 | - | 498 | WP_000605858.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD / blaCTX-M-14 | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..207369 | 207369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T291736 WP_000911313.1 NZ_LR890652:181889-182287 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|