Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 169110..169645 Replicon plasmid 2
Accession NZ_LR890652
Organism Escherichia coli isolate MINF_2E-sc-2280463

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag JMW95_RS24815 Protein ID WP_000222760.1
Coordinates 169110..169397 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag JMW95_RS24820 Protein ID WP_001132900.1
Coordinates 169394..169645 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW95_RS24790 164693..165914 - 1222 Protein_174 ISL3 family transposase -
JMW95_RS24795 166014..166378 + 365 Protein_175 IS1 family transposase -
JMW95_RS24800 166433..167215 - 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
JMW95_RS24805 167212..168234 - 1023 WP_000255956.1 IS21-like element IS100 family transposase -
JMW95_RS24810 168323..168670 + 348 Protein_178 IS1-like element IS1A family transposase -
JMW95_RS24815 169110..169397 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JMW95_RS24820 169394..169645 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW95_RS24825 170612..171469 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
JMW95_RS24830 171462..171944 - 483 WP_001273588.1 hypothetical protein -
JMW95_RS24835 171937..172011 - 75 WP_001442103.1 RepA leader peptide Tap -
JMW95_RS24840 172243..172500 - 258 WP_000083845.1 replication regulatory protein RepA -
JMW95_RS24845 172784..172990 - 207 WP_001351576.1 type I toxin-antitoxin system Hok family toxin -
- 172977..173038 + 62 NuclAT_1 - -
- 172977..173038 + 62 NuclAT_1 - -
- 172977..173038 + 62 NuclAT_1 - -
- 172977..173038 + 62 NuclAT_1 - -
JMW95_RS24850 173294..173368 - 75 Protein_186 endonuclease -
JMW95_RS24855 173614..173826 - 213 WP_001299730.1 ANR family transcriptional regulator -
JMW95_RS24860 173962..174522 - 561 WP_032072881.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / blaCTX-M-14 iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..207369 207369


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T291731 WP_000222760.1 NZ_LR890652:c169397-169110 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT291731 WP_001132900.1 NZ_LR890652:c169645-169394 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References