Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 39888..40531 Replicon plasmid 2
Accession NZ_LR890652
Organism Escherichia coli isolate MINF_2E-sc-2280463

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag JMW95_RS24170 Protein ID WP_001034044.1
Coordinates 40115..40531 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag JMW95_RS24165 Protein ID WP_001261286.1
Coordinates 39888..40118 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW95_RS24145 35450..36139 - 690 WP_001513524.1 RES family NAD+ phosphorylase -
JMW95_RS24150 36558..36788 + 231 WP_001261287.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMW95_RS24155 36785..37201 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -
JMW95_RS24160 37363..39501 - 2139 WP_001513523.1 AAA family ATPase -
JMW95_RS24165 39888..40118 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW95_RS24170 40115..40531 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW95_RS24175 40606..42171 + 1566 WP_001128474.1 AAA family ATPase -
JMW95_RS24180 42156..43178 + 1023 WP_000361402.1 helicase UvrD -
JMW95_RS24185 43432..44128 - 697 Protein_53 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / blaCTX-M-14 iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..207369 207369
- flank IS/Tn - - 43432..43944 512


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T291729 WP_001034044.1 NZ_LR890652:40115-40531 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT291729 WP_001261286.1 NZ_LR890652:39888-40118 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References