Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 33648..34173 Replicon plasmid 2
Accession NZ_LR890652
Organism Escherichia coli isolate MINF_2E-sc-2280463

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag JMW95_RS24130 Protein ID WP_001159871.1
Coordinates 33648..33953 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag JMW95_RS24135 Protein ID WP_000813630.1
Coordinates 33955..34173 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW95_RS24100 28856..29068 - 213 WP_001523378.1 hypothetical protein -
JMW95_RS24105 29797..30054 + 258 WP_015387373.1 hypothetical protein -
JMW95_RS24110 30150..30596 - 447 WP_053270998.1 hypothetical protein -
JMW95_RS24115 30761..31989 + 1229 WP_148718718.1 IS3-like element IS2 family transposase -
JMW95_RS24120 31992..32165 - 174 Protein_40 RepB family plasmid replication initiator protein -
JMW95_RS24125 32865..33647 - 783 WP_001513526.1 site-specific integrase -
JMW95_RS24130 33648..33953 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
JMW95_RS24135 33955..34173 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMW95_RS24140 34729..35418 + 690 WP_001513525.1 helix-turn-helix domain-containing protein -
JMW95_RS24145 35450..36139 - 690 WP_001513524.1 RES family NAD+ phosphorylase -
JMW95_RS24150 36558..36788 + 231 WP_001261287.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMW95_RS24155 36785..37201 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / blaCTX-M-14 iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..207369 207369


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T291727 WP_001159871.1 NZ_LR890652:c33953-33648 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT291727 WP_000813630.1 NZ_LR890652:c34173-33955 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References