Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3677646..3678483 | Replicon | chromosome |
Accession | NZ_LR890651 | ||
Organism | Escherichia coli isolate MINF_2E-sc-2280463 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | JMW95_RS17975 | Protein ID | WP_000227784.1 |
Coordinates | 3677941..3678483 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | JMW95_RS17970 | Protein ID | WP_001297137.1 |
Coordinates | 3677646..3677957 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW95_RS17945 | 3672666..3673613 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
JMW95_RS17950 | 3673635..3675626 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
JMW95_RS17955 | 3675616..3676230 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JMW95_RS17960 | 3676230..3676559 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JMW95_RS17965 | 3676571..3677461 | + | 891 | WP_000971336.1 | heme o synthase | - |
JMW95_RS17970 | 3677646..3677957 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
JMW95_RS17975 | 3677941..3678483 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
JMW95_RS17980 | 3678539..3679474 | - | 936 | WP_001368479.1 | sel1 repeat family protein | - |
JMW95_RS17985 | 3679882..3681246 | + | 1365 | WP_001000960.1 | MFS transporter | - |
JMW95_RS17990 | 3681374..3681865 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
JMW95_RS17995 | 3682033..3682944 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T291719 WP_000227784.1 NZ_LR890651:3677941-3678483 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|