Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 81563..82473 | Replicon | plasmid 2 |
Accession | NZ_LR890649 | ||
Organism | Klebsiella pneumoniae isolate INF266-sc-2280182 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A2A5MBW7 |
Locus tag | JMW87_RS26445 | Protein ID | WP_023329005.1 |
Coordinates | 81563..82033 (-) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | JMW87_RS26450 | Protein ID | WP_023329004.1 |
Coordinates | 82030..82473 (-) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW87_RS26420 | 77254..78222 | - | 969 | WP_072206835.1 | IS5 family transposase | - |
JMW87_RS26425 | 78510..78758 | + | 249 | WP_004187025.1 | plasmid stabilization protein | - |
JMW87_RS26430 | 78748..79032 | + | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
JMW87_RS26435 | 79048..80391 | - | 1344 | WP_032738442.1 | ISNCY family transposase | - |
JMW87_RS26440 | 81193..81452 | + | 260 | Protein_90 | hypothetical protein | - |
JMW87_RS26445 | 81563..82033 | - | 471 | WP_023329005.1 | RES family NAD+ phosphorylase | Toxin |
JMW87_RS26450 | 82030..82473 | - | 444 | WP_023329004.1 | DUF2384 domain-containing protein | Antitoxin |
JMW87_RS26455 | 82595..83282 | - | 688 | Protein_93 | DUF4113 domain-containing protein | - |
JMW87_RS26460 | 83443..84438 | - | 996 | WP_032738441.1 | DUF2891 domain-containing protein | - |
JMW87_RS26465 | 84448..85434 | - | 987 | Protein_95 | DUF979 domain-containing protein | - |
JMW87_RS26470 | 85431..86152 | - | 722 | Protein_96 | DUF969 domain-containing protein | - |
JMW87_RS26475 | 86351..86689 | + | 339 | WP_032738440.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..195420 | 195420 | |
- | flank | IS/Tn | - | - | 77254..78222 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17459.70 Da Isoelectric Point: 4.4829
>T291706 WP_023329005.1 NZ_LR890649:c82033-81563 [Klebsiella pneumoniae]
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIPFRFDSRLKPDRK
VILYRLTKTKNLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPANWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHSDFYGIVQMAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16477.82 Da Isoelectric Point: 10.2498
>AT291706 WP_023329004.1 NZ_LR890649:c82473-82030 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADSVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADSVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAALKWLNEPNRALSWKVPADLIASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|