Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 61535..62271 | Replicon | plasmid 2 |
| Accession | NZ_LR890649 | ||
| Organism | Klebsiella pneumoniae isolate INF266-sc-2280182 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | JMW87_RS26335 | Protein ID | WP_023329018.1 |
| Coordinates | 61535..62017 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMW87_RS26340 | Protein ID | WP_003026799.1 |
| Coordinates | 62005..62271 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW87_RS26315 | 56813..57631 | + | 819 | WP_023307220.1 | abortive infection family protein | - |
| JMW87_RS26320 | 57702..59045 | - | 1344 | WP_077263966.1 | ISNCY family transposase | - |
| JMW87_RS26325 | 59271..59903 | + | 633 | WP_001567369.1 | hypothetical protein | - |
| JMW87_RS26330 | 59932..61335 | - | 1404 | WP_001272054.1 | ISNCY-like element ISKpn21 family transposase | - |
| JMW87_RS26335 | 61535..62017 | - | 483 | WP_023329018.1 | GNAT family N-acetyltransferase | Toxin |
| JMW87_RS26340 | 62005..62271 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW87_RS26345 | 63375..63554 | + | 180 | Protein_71 | transposase | - |
| JMW87_RS26350 | 63521..63655 | + | 135 | WP_109241503.1 | integrase core domain-containing protein | - |
| JMW87_RS26355 | 63807..64616 | - | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
| JMW87_RS26360 | 64609..65817 | - | 1209 | WP_023329016.1 | imidazolonepropionase | - |
| JMW87_RS26365 | 65829..67223 | - | 1395 | WP_032738443.1 | cytosine permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..195420 | 195420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17255.84 Da Isoelectric Point: 7.8840
>T291704 WP_023329018.1 NZ_LR890649:c62017-61535 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAEGFYAHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAEGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|