Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4652389..4653199 | Replicon | chromosome |
Accession | NZ_LR890648 | ||
Organism | Klebsiella pneumoniae isolate INF266-sc-2280182 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A332NV98 |
Locus tag | JMW87_RS22805 | Protein ID | WP_014908042.1 |
Coordinates | 4652389..4652922 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | - |
Locus tag | JMW87_RS22810 | Protein ID | WP_023343051.1 |
Coordinates | 4652933..4653199 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW87_RS22800 | 4651220..4652341 | + | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
JMW87_RS22805 | 4652389..4652922 | - | 534 | WP_014908042.1 | GNAT family N-acetyltransferase | Toxin |
JMW87_RS22810 | 4652933..4653199 | - | 267 | WP_023343051.1 | DUF1778 domain-containing protein | Antitoxin |
JMW87_RS22815 | 4653302..4654735 | - | 1434 | WP_023343050.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
JMW87_RS22820 | 4654725..4655408 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
JMW87_RS22825 | 4655581..4656966 | + | 1386 | WP_024623207.1 | efflux transporter outer membrane subunit | - |
JMW87_RS22830 | 4656984..4657328 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19795.68 Da Isoelectric Point: 5.2614
>T291700 WP_014908042.1 NZ_LR890648:c4652922-4652389 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|