Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4220479..4221185 | Replicon | chromosome |
Accession | NZ_LR890648 | ||
Organism | Klebsiella pneumoniae isolate INF266-sc-2280182 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | JMW87_RS20775 | Protein ID | WP_024622903.1 |
Coordinates | 4220817..4221185 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A485WAM6 |
Locus tag | JMW87_RS20770 | Protein ID | WP_023302278.1 |
Coordinates | 4220479..4220796 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW87_RS20725 | 4215620..4216444 | + | 825 | WP_023302271.1 | DUF945 domain-containing protein | - |
JMW87_RS20730 | 4216653..4217363 | + | 711 | WP_023302272.1 | DeoR family transcriptional regulator | - |
JMW87_RS20735 | 4217389..4217925 | + | 537 | WP_023302273.1 | DUF4339 domain-containing protein | - |
JMW87_RS20740 | 4217967..4218404 | + | 438 | WP_023301392.1 | hypothetical protein | - |
JMW87_RS20745 | 4218471..4218881 | + | 411 | WP_023302274.1 | hypothetical protein | - |
JMW87_RS20750 | 4218959..4219195 | + | 237 | WP_032410024.1 | DUF905 domain-containing protein | - |
JMW87_RS20755 | 4219282..4219740 | + | 459 | WP_023302275.1 | antirestriction protein | - |
JMW87_RS20760 | 4219749..4220231 | + | 483 | WP_023302276.1 | RadC family protein | - |
JMW87_RS20765 | 4220240..4220461 | + | 222 | WP_023302277.1 | DUF987 domain-containing protein | - |
JMW87_RS20770 | 4220479..4220796 | + | 318 | WP_023302278.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW87_RS20775 | 4220817..4221185 | + | 369 | WP_024622903.1 | TA system toxin CbtA family protein | Toxin |
JMW87_RS20780 | 4221182..4221523 | + | 342 | WP_024622904.1 | hypothetical protein | - |
JMW87_RS20785 | 4221646..4224291 | - | 2646 | WP_024622905.1 | LuxR family transcriptional regulator | - |
JMW87_RS20790 | 4224665..4225624 | + | 960 | WP_023302280.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13651.82 Da Isoelectric Point: 7.2897
>T291699 WP_024622903.1 NZ_LR890648:4220817-4221185 [Klebsiella pneumoniae]
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|