Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 85710..86446 | Replicon | plasmid 2 |
Accession | NZ_LR890641 | ||
Organism | Klebsiella pneumoniae isolate INF344-sc-2280162 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | JMW76_RS25325 | Protein ID | WP_003026803.1 |
Coordinates | 85710..86192 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMW76_RS25330 | Protein ID | WP_003026799.1 |
Coordinates | 86180..86446 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW76_RS25305 | 81555..82988 | - | 1434 | WP_004016055.1 | restriction endonuclease | - |
JMW76_RS25310 | 83009..83782 | - | 774 | WP_118897055.1 | TIGR02391 family protein | - |
JMW76_RS25320 | 85018..85329 | - | 312 | Protein_90 | hypothetical protein | - |
JMW76_RS25325 | 85710..86192 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
JMW76_RS25330 | 86180..86446 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMW76_RS25335 | 86691..87125 | - | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
JMW76_RS25340 | 87172..87720 | - | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
JMW76_RS25345 | 88214..88522 | + | 309 | WP_017896554.1 | hypothetical protein | - |
JMW76_RS25350 | 89747..90238 | - | 492 | WP_032249453.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / qnrB1 / dfrA14 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B | - | 1..190324 | 190324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T291671 WP_003026803.1 NZ_LR890641:c86192-85710 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |