Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 65366..66009 Replicon plasmid 2
Accession NZ_LR890641
Organism Klebsiella pneumoniae isolate INF344-sc-2280162

Toxin (Protein)


Gene name vagD Uniprot ID A0A5Q9LNG2
Locus tag JMW76_RS25245 Protein ID WP_048983057.1
Coordinates 65366..65782 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID R4IT22
Locus tag JMW76_RS25250 Protein ID WP_016338373.1
Coordinates 65779..66009 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW76_RS25225 61289..62257 - 969 WP_000654811.1 IS5 family transposase -
JMW76_RS25230 62286..62522 - 237 Protein_72 colicin V synthesis protein -
JMW76_RS25235 62512..63789 - 1278 WP_016338369.1 HlyD family secretion protein -
JMW76_RS25240 64448..65325 + 878 Protein_74 restriction endonuclease -
JMW76_RS25245 65366..65782 - 417 WP_048983057.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW76_RS25250 65779..66009 - 231 WP_016338373.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW76_RS25255 66654..67670 - 1017 WP_001407551.1 IS5-like element IS5 family transposase -
JMW76_RS25260 67680..68348 - 669 WP_032249507.1 response regulator transcription factor -
JMW76_RS25265 68546..69514 - 969 WP_077265821.1 IS5 family transposase -
JMW76_RS25270 69844..70140 + 297 WP_001542733.1 helix-turn-helix domain-containing protein -
JMW76_RS25275 70402..70590 - 189 Protein_81 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / qnrB1 / dfrA14 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B - 1..190324 190324
- inside IScluster/Tn - - 61289..69514 8225


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15022.52 Da        Isoelectric Point: 9.2957

>T291670 WP_048983057.1 NZ_LR890641:c65782-65366 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8751.77 Da        Isoelectric Point: 4.3533

>AT291670 WP_016338373.1 NZ_LR890641:c66009-65779 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWSSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNG2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Q9LN61

References