Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3241266..3241782 | Replicon | chromosome |
Accession | NZ_LR890640 | ||
Organism | Klebsiella pneumoniae isolate INF344-sc-2280162 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A085DK79 |
Locus tag | JMW76_RS15730 | Protein ID | WP_009309309.1 |
Coordinates | 3241266..3241550 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMW76_RS15735 | Protein ID | WP_002886901.1 |
Coordinates | 3241540..3241782 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW76_RS15705 | 3236749..3237057 | - | 309 | WP_016947038.1 | PTS sugar transporter subunit IIB | - |
JMW76_RS15710 | 3237142..3237315 | + | 174 | WP_002886906.1 | hypothetical protein | - |
JMW76_RS15715 | 3237318..3238061 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMW76_RS15720 | 3238418..3240556 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMW76_RS15725 | 3240798..3241262 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMW76_RS15730 | 3241266..3241550 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW76_RS15735 | 3241540..3241782 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMW76_RS15740 | 3241860..3243770 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
JMW76_RS15745 | 3243793..3244947 | - | 1155 | WP_021313684.1 | lactonase family protein | - |
JMW76_RS15750 | 3245014..3245754 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T291663 WP_009309309.1 NZ_LR890640:c3241550-3241266 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085DK79 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |