291661

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2533035..2533654 Replicon chromosome
Accession NZ_LR890640
Organism Klebsiella pneumoniae isolate INF344-sc-2280162

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW76_RS12385 Protein ID WP_002892050.1
Coordinates 2533436..2533654 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW76_RS12380 Protein ID WP_002892066.1
Coordinates 2533035..2533409 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW76_RS12370 2528187..2529380 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW76_RS12375 2529403..2532549 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW76_RS12380 2533035..2533409 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW76_RS12385 2533436..2533654 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW76_RS12390 2533817..2534383 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW76_RS12395 2534355..2534495 - 141 WP_201524398.1 hypothetical protein -
JMW76_RS12400 2534516..2534986 + 471 WP_104159009.1 YlaC family protein -
JMW76_RS12405 2534961..2536412 - 1452 WP_201524399.1 PLP-dependent aminotransferase family protein -
JMW76_RS12410 2536513..2537211 + 699 WP_094310543.1 GNAT family N-acetyltransferase -
JMW76_RS12415 2537208..2537348 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW76_RS12420 2537348..2537611 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -
JMW76_RS12425 2537753..2538349 + 597 Protein_2439 GNAT family N-acetyltransferase -
JMW76_RS12430 2538346..2538486 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291661 WP_002892050.1 NZ_LR890640:2533436-2533654 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291661 WP_002892066.1 NZ_LR890640:2533035-2533409 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References